Structure of PDB 6ulp Chain A Binding Site BS01

Receptor Information
>6ulp Chain A (length=110) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPM
DLSTVKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQD
VFEMRFAKMP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ulp Cyclic peptides can engage a single binding pocket through highly divergent modes.
Resolution2.8 Å
Binding residue
(original residue number in PDB)
A328 W332 L343 E344 L345
Binding residue
(residue number reindexed from 1)
A22 W26 L37 E38 L39
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6ulp, PDBe:6ulp, PDBj:6ulp
PDBsum6ulp
PubMed33046654
UniProtQ15059|BRD3_HUMAN Bromodomain-containing protein 3 (Gene Name=BRD3)

[Back to BioLiP]