Structure of PDB 6ulk Chain A Binding Site BS01

Receptor Information
>6ulk Chain A (length=273) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGEPRAPW
VEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMYGC
DLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADKAAQITQRKWEAAR
EAEQRRAYLEGTCVEWLRRYLENGKKTLQRAEHPKTHVTHHPVSDHEATL
RCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPS
GEEQRYTCHVQHEGLPEPLTLRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ulk High-affinity oligoclonal TCRs define effective adoptive T cell therapy targeting mutant KRAS-G12D.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y7 E63 K66 Q70 S77 N80 Y84 Y99 Y123 T143 K146 W147 A150 E152 Q155 R156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y6 E62 K65 Q69 S76 N79 Y83 Y98 Y122 T142 K145 W146 A149 E151 Q154 R155 Y158 W166 Y170
Enzymatic activity
Enzyme Commision number ?
External links