Structure of PDB 6ulf Chain A Binding Site BS01

Receptor Information
>6ulf Chain A (length=230) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVESGGGVVQPGRSLRLSCAASGFTFSIYGMHWVRQAPGKGLEWVAL
IWYDGTNKYYTDSVKGRFTISRDNSKNTLFLQMNSVRAEDTAVYYCARDA
HYSDSSGYSSWGYFDYWGQGSLVTVSSASTKGPSVFPLAPSSKSTSGGTA
ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS
SSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Ligand information
>6ulf Chain P (length=11) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ANPNVDPNANP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ulf Evolution of protective human antibodies against Plasmodium falciparum circumsporozoite protein repeat motifs.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		I31 Y32 G33 W52 Y53 Y59 D99 H101 W111
Binding residue
(residue number reindexed from 1)		I31 Y32 G33 W52 Y53 Y59 D99 H101 W111
External links