Structure of PDB 6ule Chain A Binding Site BS01

Receptor Information
>6ule Chain A (length=223) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQTTGKGLEWVAI
IWHDGSKKYYADSVKGRLTISRDNSKNTLYLQMNSLRVEDTALYYCARVG
DYSDFKYGAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSSGGTAALGCL
VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPK
Ligand information
>6ule Chain I (length=17) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NPNANPNANPNANPNAN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ule Evolution of protective human antibodies against Plasmodium falciparum circumsporozoite protein repeat motifs.
Resolution2.55 Å
Binding residue
(original residue number in PDB)		S31 Y32 G33 W52 H52A V95 D97 K100B Y100C
Binding residue
(residue number reindexed from 1)		S31 Y32 G33 W52 H53 V99 D101 K106 Y107
External links