Structure of PDB 6uk4 Chain A Binding Site BS01

Receptor Information
>6uk4 Chain A (length=275) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYG
CDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAA
HVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEAT
LRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP
SGQEQRYTCHVQHEGLPKPLTLRWE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uk4 Structural dissimilarity from self drives neoepitope escape from immune tolerance.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Y7 Y9 M45 Y59 E63 K66 V67 A69 H70 T73 V76 D77 Y84 Y99 H114 Y116 T143 K146 W147 V152 L156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 Y9 M45 Y59 E63 K66 V67 A69 H70 T73 V76 D77 Y84 Y99 H114 Y116 T143 K146 W147 V152 L156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links