Structure of PDB 6ujo Chain A Binding Site BS01

Receptor Information

>6ujo Chain A (length=275) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GSHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYG
CDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAA
HVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEAT
LRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP
SGQEQRYTCHVQHEGLPKPLTLRWE

Ligand information

>6ujo Chain C (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KQWLVWLFL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6ujo Structural dissimilarity from self drives neoepitope escape from immune tolerance.
Resolution	2.25 Å
Binding residue (original residue number in PDB)	Y7 Y9 M45 E63 K66 V67 A69 H70 Q72 T73 D77 R97 Y99 T143 K146 W147 L156 Y159 W167 Y171
Binding residue (residue number reindexed from 1)	Y7 Y9 M45 E63 K66 V67 A69 H70 Q72 T73 D77 R97 Y99 T143 K146 W147 L156 Y159 W167 Y171

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:6ujo, PDBe:6ujo, PDBj:6ujo
PDBsum	6ujo
PubMed	32807968
UniProt	U5YJP1

[Back to BioLiP]