Structure of PDB 6uib Chain A Binding Site BS01

Receptor Information
>6uib Chain A (length=132) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPAWTQCQQLSQKLCTLAWSAHPLVGHTNDVPHIQCGDGCDPQGLRDNSQ
FCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQP
WQRLLLRFKILRSLQAFVAVAARVFAHGAATL
Ligand information
>6uib Chain C (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TKSFCYFGTWCQMYG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uib Integration of phage and yeast display platforms: A reliable and cost effective approach for binning of peptides as displayed on-phage.
Resolution2.74 Å
Binding residue
(original residue number in PDB)		K20 C22 T23 W26 S27 P30 L31
Binding residue
(residue number reindexed from 1)		K13 C15 T16 W19 S20 P23 L24
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005125 cytokine activity
GO:0005515 protein binding
GO:0045519 interleukin-23 receptor binding
Biological Process
GO:0001916 positive regulation of T cell mediated cytotoxicity
GO:0002230 positive regulation of defense response to virus by host
GO:0002827 positive regulation of T-helper 1 type immune response
GO:0006954 inflammatory response
GO:0006955 immune response
GO:0007259 cell surface receptor signaling pathway via JAK-STAT
GO:0032693 negative regulation of interleukin-10 production
GO:0032725 positive regulation of granulocyte macrophage colony-stimulating factor production
GO:0032729 positive regulation of type II interferon production
GO:0032733 positive regulation of interleukin-10 production
GO:0032735 positive regulation of interleukin-12 production
GO:0032740 positive regulation of interleukin-17 production
GO:0032760 positive regulation of tumor necrosis factor production
GO:0032816 positive regulation of natural killer cell activation
GO:0032819 positive regulation of natural killer cell proliferation
GO:0034105 positive regulation of tissue remodeling
GO:0042098 T cell proliferation
GO:0042102 positive regulation of T cell proliferation
GO:0042104 positive regulation of activated T cell proliferation
GO:0043382 positive regulation of memory T cell differentiation
GO:0045087 innate immune response
GO:0045672 positive regulation of osteoclast differentiation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0048771 tissue remodeling
GO:0050729 positive regulation of inflammatory response
GO:0050829 defense response to Gram-negative bacterium
GO:0051135 positive regulation of NK T cell activation
GO:0051142 positive regulation of NK T cell proliferation
GO:0051607 defense response to virus
GO:0090023 positive regulation of neutrophil chemotaxis
GO:0097696 cell surface receptor signaling pathway via STAT
GO:1901224 positive regulation of non-canonical NF-kappaB signal transduction
GO:2000318 positive regulation of T-helper 17 type immune response
GO:2000330 positive regulation of T-helper 17 cell lineage commitment
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005788 endoplasmic reticulum lumen
GO:0070743 interleukin-23 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6uib, PDBe:6uib, PDBj:6uib
PDBsum6uib
PubMed32479512
UniProtQ9NPF7|IL23A_HUMAN Interleukin-23 subunit alpha (Gene Name=IL23A)

[Back to BioLiP]