Structure of PDB 6uej Chain A Binding Site BS01

Receptor Information
>6uej Chain A (length=212) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADPEVCCFITKILCAHGGRMALDALLQEIALSEPQLCEVLQVAGPDRFVV
LEITRSVVATTRARVCRRKYCQRPCDNLHLCKLNLLGRCNYSNLCKYSHE
VLSEENFKVLKNHELSGLNKEELAVLLLQSDPFFMPEICKSYKGEGRQQI
CNQCSRLHICDHFTRGNCRFPNCLRSHNLMDRKVLAIMREHGLNPDVVQN
IQDICNSKHMQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uej Structure of the zinc-finger antiviral protein in complex with RNA reveals a mechanism for selective targeting of CG-rich viral sequences.
Resolution2.21 Å
Binding residue
(original residue number in PDB)		R74 C88 K89 L90 Y98 K107 Y108 F144
Binding residue
(residue number reindexed from 1)		R67 C81 K82 L83 Y91 K96 Y97 F133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:6uej, PDBe:6uej, PDBj:6uej
PDBsum6uej
PubMed31719195
UniProtQ7Z2W4|ZCCHV_HUMAN Zinc finger CCCH-type antiviral protein 1 (Gene Name=ZC3HAV1)

[Back to BioLiP]