Structure of PDB 6uab Chain A Binding Site BS01

Receptor Information
>6uab Chain A (length=155) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGV
QRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISF
GAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLE
Ligand information
>6uab Chain B (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IWKGQGGRRLGDEINAYYARR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uab Inhibitor peptides against Mcl-1 containing non-natural amino acids show potent apoptotic response.
Resolution2.1 Å
Binding residue
(original residue number in PDB)
H224 V249 H252 V253 N260 G262 R263 T266 F318 F319 E322
Binding residue
(residue number reindexed from 1)
H54 V79 H82 V83 N90 G92 R93 T96 F148 F149 E152
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:6uab, PDBe:6uab, PDBj:6uab
PDBsum6uab
PubMed
UniProtQ07820|MCL1_HUMAN Induced myeloid leukemia cell differentiation protein Mcl-1 (Gene Name=MCL1)

[Back to BioLiP]