Structure of PDB 6ua3 Chain A Binding Site BS01

Receptor Information
>6ua3 Chain A (length=155) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGV
QRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISF
GAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLE
Ligand information
>6ua3 Chain B (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IWKGQGFRRLGDEINAYYARR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ua3 Inhibitor peptides against Mcl-1 containing non-natural amino acids show potent apoptotic response.
Resolution1.552 Å
Binding residue
(original residue number in PDB)		V220 H224 M231 H252 V253 N260 G262 R263 T266 L267 F270 F318 F319
Binding residue
(residue number reindexed from 1)		V50 H54 M61 H82 V83 N90 G92 R93 T96 L97 F100 F148 F149
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:6ua3, PDBe:6ua3, PDBj:6ua3
PDBsum6ua3
PubMed
UniProtQ07820|MCL1_HUMAN Induced myeloid leukemia cell differentiation protein Mcl-1 (Gene Name=MCL1)

[Back to BioLiP]