Structure of PDB 6u8i Chain A Binding Site BS01

Receptor Information
>6u8i Chain A (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDM
STIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVF
EMRFAKMPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6u8i Cyclic peptides can engage a single binding pocket through highly divergent modes.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
W374 P375 F376 K378 L385 L387 H437 E438
Binding residue
(residue number reindexed from 1)
W24 P25 F26 K28 L35 L37 H87 E88
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6u8i, PDBe:6u8i, PDBj:6u8i
PDBsum6u8i
PubMed33046654
UniProtO60885|BRD4_HUMAN Bromodomain-containing protein 4 (Gene Name=BRD4)

[Back to BioLiP]