Structure of PDB 6u8h Chain A Binding Site BS01

Receptor Information
>6u8h Chain A (length=128) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPD
YHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDI
VLMAQTLEKIFLQKVASMPQEEQELVVT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6u8h Cyclic peptides can engage a single binding pocket through highly divergent modes.
Resolution2.07 Å
Binding residue
(original residue number in PDB)
W97 P98 F99 Q101 V103 L108 L110 N156 I162
Binding residue
(residue number reindexed from 1)
W35 P36 F37 Q39 V41 L46 L48 N94 I100
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6u8h, PDBe:6u8h, PDBj:6u8h
PDBsum6u8h
PubMed33046654
UniProtP25440|BRD2_HUMAN Bromodomain-containing protein 2 (Gene Name=BRD2)

[Back to BioLiP]