Structure of PDB 6u81 Chain A Binding Site BS01

Receptor Information
>6u81 Chain A (length=132) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQIWFQ
NERSRQLRQHRRESRPWPGRRGPPEGRRKRTAVTGSQTALLLRAFEKDRF
PGIAAREELARETGLPESRIQIWFQNRRARHP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6u81 DNA aptamers against the DUX4 protein reveal novel therapeutic implications for FSHD.
Resolution2.34 Å
Binding residue
(original residue number in PDB)		R20 R21 R23 L24 W26 R62 I65 N69 R73 R98 F118 R124 Q139 Q143 R146
Binding residue
(residue number reindexed from 1)		R2 R3 R5 L6 W8 R44 I47 N51 R55 R80 F100 R106 Q121 Q125 R128
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6u81, PDBe:6u81, PDBj:6u81
PDBsum6u81
PubMed32020675
UniProtQ9UBX2|DUX4_HUMAN Double homeobox protein 4 (Gene Name=DUX4)

[Back to BioLiP]