Structure of PDB 6u74 Chain A Binding Site BS01

Receptor Information
>6u74 Chain A (length=128) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LGSSTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVD
AVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYI
YNKPGDDIVLMAEALEKLFLQKINELPT
Ligand information
>6u74 Chain E (length=14) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WKTIKGKTWRTKQC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6u74 Cyclic peptides can engage a single binding pocket through highly divergent modes.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		F83 V87 L94 I100 I138 Y139 N140 K141 D144 D145
Binding residue
(residue number reindexed from 1)		F45 V49 L56 I62 I100 Y101 N102 K103 D106 D107
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6u74, PDBe:6u74, PDBj:6u74
PDBsum6u74
PubMed33046654
UniProtO60885|BRD4_HUMAN Bromodomain-containing protein 4 (Gene Name=BRD4)

[Back to BioLiP]