Structure of PDB 6u71 Chain A Binding Site BS01

Receptor Information
>6u71 Chain A (length=110) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMD
LSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDV
FEFRYAKMPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6u71 Cyclic peptides can engage a single binding pocket through highly divergent modes.
Resolution1.47 Å
Binding residue
(original residue number in PDB)
W370 P371 V376 L381 N429 H433 D434 V435
Binding residue
(residue number reindexed from 1)
W25 P26 V31 L36 N84 H88 D89 V90
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6u71, PDBe:6u71, PDBj:6u71
PDBsum6u71
PubMed33046654
UniProtP25440|BRD2_HUMAN Bromodomain-containing protein 2 (Gene Name=BRD2)

[Back to BioLiP]