Structure of PDB 6u6l Chain A Binding Site BS01

Receptor Information
>6u6l Chain A (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHP
MDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQ
DVFEMRFAKMPD
Ligand information
>6u6l Chain B (length=14) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WKTIKGKTWRTKQC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6u6l Cyclic peptides can engage a single binding pocket through highly divergent modes.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		F376 L387 N433 E438
Binding residue
(residue number reindexed from 1)		F29 L40 N86 E91
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6u6l, PDBe:6u6l, PDBj:6u6l
PDBsum6u6l
PubMed33046654
UniProtO60885|BRD4_HUMAN Bromodomain-containing protein 4 (Gene Name=BRD4)

[Back to BioLiP]