Structure of PDB 6u6k Chain A Binding Site BS01

Receptor Information
>6u6k Chain A (length=126) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVK
LNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNK
PGDDIVLMAEALEKLFLQKINELPTE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6u6k Cyclic peptides can engage a single binding pocket through highly divergent modes.
Resolution1.7 Å
Binding residue
(original residue number in PDB)
F79 W81 V87 L92 N140 D144 D145 I146 M149
Binding residue
(residue number reindexed from 1)
F38 W40 V46 L51 N99 D103 D104 I105 M108
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6u6k, PDBe:6u6k, PDBj:6u6k
PDBsum6u6k
PubMed33046654
UniProtO60885|BRD4_HUMAN Bromodomain-containing protein 4 (Gene Name=BRD4)

[Back to BioLiP]