Structure of PDB 6u4a Chain A Binding Site BS01

Receptor Information
>6u4a Chain A (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKII
KNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQ
ALEKIFLQKVAQMPQEEVEL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6u4a Cyclic peptides can engage a single binding pocket through highly divergent modes.
Resolution1.88 Å
Binding residue
(original residue number in PDB)
W57 V63 L68 N116 D120 D121 I122 M125
Binding residue
(residue number reindexed from 1)
W30 V36 L41 N89 D93 D94 I95 M98
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6u4a, PDBe:6u4a, PDBj:6u4a
PDBsum6u4a
PubMed33046654
UniProtQ15059|BRD3_HUMAN Bromodomain-containing protein 3 (Gene Name=BRD3)

[Back to BioLiP]