Structure of PDB 6u3m Chain A Binding Site BS01

Receptor Information
>6u3m Chain A (length=181) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWSLPVLR
QFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLG
QPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISY
LTLLPSAEESYDCKVEHWGLDKPLLKHWEPE
Ligand information
>6u3m Chain E (length=11) Species: 294 (Pseudomonas fluorescens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QPMPMPELPYP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6u3m T cell receptor cross-reactivity between gliadin and bacterial peptides in celiac disease.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y9 H24 F51 F54 F58 N62 V65 N69 S72 L73 R76
Binding residue
(residue number reindexed from 1)		Y9 H25 F52 F54 F58 N62 V65 N69 S72 L73 R76
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6u3m, PDBe:6u3m, PDBj:6u3m
PDBsum6u3m
PubMed31873306
UniProtP01909|DQA1_HUMAN HLA class II histocompatibility antigen, DQ alpha 1 chain (Gene Name=HLA-DQA1)

[Back to BioLiP]