Structure of PDB 6u15 Chain A Binding Site BS01

Receptor Information
>6u15 Chain A (length=195) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRFNGVSEAELLTKTLPDILTFNLDIVIIGIAPGLMAAYKGHHYPGPGNH
FWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEF
REGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHK
IPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6u15 Excision of 5-Carboxylcytosine by Thymine DNA Glycosylase.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		P155 A274 R275 C276 A277 P280 R281
Binding residue
(residue number reindexed from 1)		P47 A166 R167 C168 A169 P172 R173
Enzymatic activity
Enzyme Commision number 3.2.2.29: thymine-DNA glycosylase.
Gene Ontology
Molecular Function
GO:0000700 mismatch base pair DNA N-glycosylase activity
Biological Process
GO:0006285 base-excision repair, AP site formation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6u15, PDBe:6u15, PDBj:6u15
PDBsum6u15
PubMed31693361
UniProtQ13569|TDG_HUMAN G/T mismatch-specific thymine DNA glycosylase (Gene Name=TDG)

[Back to BioLiP]