Structure of PDB 6trr Chain A Binding Site BS01

Receptor Information
>6trr Chain A (length=140) Species: 132475 (Yaba-like disease virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CNFNNSIKNVIVFYINEKALIEEKKMLSCYENKLLNLIKEDCENIMLKYK
PNLSYICSLLKVDDTSEENIKHIKDQIIESLENDNRPSVKLAIISLISMI
VEMNGYKGKNIPMSFLIEDIALKISENSEDLINFINIKNK
Ligand information
>6trr Chain B (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
STKKLSECLKRIGDELDSNME
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6trr Structural insight into tanapoxvirus-mediated inhibition of apoptosis.
Resolution2.12007 Å
Binding residue
(original residue number in PDB)		Y53 N56 Y59 I60 Q80 S84 R90 S92 I97 F138 I141 K142
Binding residue
(residue number reindexed from 1)		Y49 N52 Y55 I56 Q76 S80 R86 S88 I93 F134 I137 K138
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0033668 symbiont-mediated suppression of host apoptosis
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:6trr, PDBe:6trr, PDBj:6trr
PDBsum6trr
PubMed32412687
UniProtQ9DHU6

[Back to BioLiP]