Structure of PDB 6tqq Chain A Binding Site BS01

Receptor Information
>6tqq Chain A (length=137) Species: 132475 (Yaba-like disease virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NFNNSIKNVIVFYINEKALIEEKKMLSCYENKLLNLIKEDCENIMLKYKP
NLSYICSLLKVDDTSEENIKHIKDQIIESLENNRPSVKLAIISLISMIVE
MNGYKGKNIPMSFLIEDIALKISENSEDLINFINIKN
Ligand information
>6tqq Chain B (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DMRPEIWIAQELRRIGDEFNAY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tqq Structural insight into tanapoxvirus-mediated inhibition of apoptosis.
Resolution3.0018 Å
Binding residue
(original residue number in PDB)		I49 Y53 N56 I60 L63 L64 Q80 R90 S92 F138
Binding residue
(residue number reindexed from 1)		I44 Y48 N51 I55 L58 L59 Q75 R84 S86 F132
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0033668 symbiont-mediated suppression of host apoptosis
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:6tqq, PDBe:6tqq, PDBj:6tqq
PDBsum6tqq
PubMed32412687
UniProtQ9DHU6

[Back to BioLiP]