Structure of PDB 6tqp Chain A Binding Site BS01

Receptor Information
>6tqp Chain A (length=142) Species: 132475 (Yaba-like disease virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSCNFNNSIKNVIVFYINEKALIEEKKMLSCYENKLLNLIKEDCENIMLK
YKPNLSYICSLLKVDDTSEENIKHIKDQIIESLENDNRPSVKLAIISLIS
MIVEMNGYKGKNIPMSFLIEDIALKISENSEDLINFINIKNK
Ligand information
>6tqp Chain B (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EEQWAREIGAQLRRMADDLNAQYERR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tqp Structural insight into tanapoxvirus-mediated inhibition of apoptosis.
Resolution1.84941 Å
Binding residue
(original residue number in PDB)		I49 K52 Y53 N56 L63 H76 D79 Q80 E83 S84 R90 S92 F138 I141 K142
Binding residue
(residue number reindexed from 1)		I47 K50 Y51 N54 L61 H74 D77 Q78 E81 S82 R88 S90 F136 I139 K140
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0033668 symbiont-mediated suppression of host apoptosis
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:6tqp, PDBe:6tqp, PDBj:6tqp
PDBsum6tqp
PubMed32412687
UniProtQ9DHU6

[Back to BioLiP]