Structure of PDB 6tj1 Chain A Binding Site BS01

Receptor Information
>6tj1 Chain A (length=71) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGSHMTEDEIRKLRKLLEEAEKKLYKLEDKTRRSEEISDDPKAQSLQLIA
ESLMLIAESLLIIAISLLLSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tj1 Computational design of transmembrane pores.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		I5 R6 E13
Binding residue
(residue number reindexed from 1)		I10 R11 E18
External links