Structure of PDB 6tc9 Chain A Binding Site BS01

Receptor Information
>6tc9 Chain A (length=259) Species: 996307 (Neisseria meningitidis alpha522) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PELPEVETTLRGIAPHIEGKTVEAVVLRQLLRWQINPDLGEILSGRQVLS
CGRRAKYLLIRFQTGVLLIHLGMSGSLRIFTPSDGRIGRPDRHDHVDIVF
SDGTVMRYRDPRKFGAILWYEGIEEHHPLLEKLGPEPLSEAFCADYLYAR
LKAQKRAVKLALMDNAVVVGVGNIYANESLFRAGISPHRPANRLKKKECA
LLVETVKAVLQRAIETGGYFQQEYTVYGRHNQPCPRCGGLVVKETLGQRG
TFYCPNCQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tc9 Conformational changes of DNA repair glycosylase MutM triggered by DNA binding.
Resolution2.175 Å
Binding residue
(original residue number in PDB)
P2 E3 R34 W35 K58 H72 G74 M75 R114 F116 L131 N175 I176 Y243 K259 R265
Binding residue
(residue number reindexed from 1)
P1 E2 R32 W33 K56 H70 G72 M73 R112 F114 L129 N173 I174 Y227 K243 R249
Enzymatic activity
Enzyme Commision number 3.2.2.23: DNA-formamidopyrimidine glycosylase.
4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0008270 zinc ion binding
GO:0008534 oxidized purine nucleobase lesion DNA N-glycosylase activity
GO:0016787 hydrolase activity
GO:0016798 hydrolase activity, acting on glycosyl bonds
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0016829 lyase activity
GO:0019104 DNA N-glycosylase activity
GO:0034039 8-oxo-7,8-dihydroguanine DNA N-glycosylase activity
GO:0046872 metal ion binding
GO:0140078 class I DNA-(apurinic or apyrimidinic site) endonuclease activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:6tc9, PDBe:6tc9, PDBj:6tc9
PDBsum6tc9
PubMed32598485
UniProtI4E596

[Back to BioLiP]