Structure of PDB 6tbz Chain A Binding Site BS01

Receptor Information
>6tbz Chain A (length=127) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPAVKRLLGWKQGEQNGQEEKWAEKAVDALVKKLKKKKGAMEELEKALSS
PGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLD
ICEFPFGSKQKEVCINPYHYKRVESPV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tbz Unveiling the dimer/monomer propensities of Smad MH1-DNA complexes.
Resolution1.782 Å
Binding residue
(original residue number in PDB)		L72 Q77 S79 H80
Binding residue
(residue number reindexed from 1)		L64 Q69 S71 H72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005667 transcription regulator complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tbz, PDBe:6tbz, PDBj:6tbz
PDBsum6tbz
PubMed33510867
UniProtQ56I99|SMAD5_CHICK Mothers against decapentaplegic homolog 5 (Gene Name=SMAD5)

[Back to BioLiP]