Structure of PDB 6t7y Chain A Binding Site BS01

Receptor Information

>6t7y Chain A (length=238) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PFEIVFEGAKEFAQLIETASRLIDEAAFKVTEEGISMRAMDPSRVVLIDL
NLPASIFSKYEVDGEETIGVNMDHLKKVLKRGKAKETLILRKGEENFLEI
SLQGTATRTFKLPLIDVELPFTAKVVILGDVIKEAVKDASLVSDSMKFIA
KENEFTMRAEGETQEVEVKLTLEDEGLLDIEVQEETKSAYGISYLSDMVK
GLGKADEVTIKFGNEMPMQMEYYIRDEGRLIFLLAPRV

Ligand information

>6t7y Chain B (length=9) Species: 29292 (Pyrococcus abyssi) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KRVISLEEF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6t7y Structural basis for the increased processivity of D-family DNA polymerases in complex with PCNA.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	R45 V46 V47 L48 M225 P226 R246 V247
Binding residue (residue number reindexed from 1)	R44 V45 V46 L47 M216 P217 R237 V238

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0030337	DNA polymerase processivity factor activity

	Biological Process
GO:0006260	DNA replication
GO:0006272	leading strand elongation
GO:0006275	regulation of DNA replication

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6t7y, PDBe:6t7y, PDBj:6t7y
PDBsum	6t7y
PubMed	32221299
UniProt	Q9UYX8\|PCNA_PYRAB DNA polymerase sliding clamp (Gene Name=pcn)

[Back to BioLiP]