Structure of PDB 6t78 Chain A Binding Site BS01

Receptor Information
>6t78 Chain A (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEK
IPFIREAERLRLKHMADYPDYKYRPRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6t78 Nucleosome-bound SOX2 and SOX11 structures elucidate pioneer factor function.
Resolution2.504 Å
Binding residue
(original residue number in PDB)
R51 N54 F56 M57 S80 W87 K88 Y118
Binding residue
(residue number reindexed from 1)
R6 N9 F11 M12 S35 W42 K43 Y73
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6t78, PDBe:6t78, PDBj:6t78
PDBsum6t78
PubMed32350470
UniProtP35716|SOX11_HUMAN Transcription factor SOX-11 (Gene Name=SOX11)

[Back to BioLiP]