Structure of PDB 6t36 Chain A Binding Site BS01

Receptor Information
>6t36 Chain A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRINPESPADTCIPKLN
EGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6t36 Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
Resolution1.86 Å
Binding residue
(original residue number in PDB)		K520 F521 F523 N524 L525 K526 D530 Q531 S538 H572 D573
Binding residue
(residue number reindexed from 1)		K16 F17 F19 N20 L21 K22 D26 Q27 S34 H68 D69
Enzymatic activity
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
Gene Ontology
Molecular Function
GO:0001784 phosphotyrosine residue binding
GO:0004721 phosphoprotein phosphatase activity
GO:0004725 protein tyrosine phosphatase activity
GO:0005515 protein binding
GO:0008092 cytoskeletal protein binding
GO:0017080 sodium channel regulator activity
GO:0051117 ATPase binding
Biological Process
GO:0000165 MAPK cascade
GO:0006470 protein dephosphorylation
GO:0016311 dephosphorylation
GO:0042059 negative regulation of epidermal growth factor receptor signaling pathway
GO:0045930 negative regulation of mitotic cell cycle
GO:0051045 negative regulation of membrane protein ectodomain proteolysis
GO:0097421 liver regeneration
GO:0098902 regulation of membrane depolarization during action potential
GO:2000649 regulation of sodium ion transmembrane transporter activity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0009898 cytoplasmic side of plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6t36, PDBe:6t36, PDBj:6t36
PDBsum6t36
PubMed33441627
UniProtP26045|PTN3_HUMAN Tyrosine-protein phosphatase non-receptor type 3 (Gene Name=PTPN3)

[Back to BioLiP]