Structure of PDB 6t22 Chain A Binding Site BS01

Receptor Information
>6t22 Chain A (length=145) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EFMHVFDNNGIELKAECSIGEEDGVYGLILESWGPGDRNKDYNIALDYII
ERLVDSGVSQVVVYLASSSVRKHMHSLDERKIHPGEYFTLIGNSPRDIRL
KMCGYQAYFSRTGRKEIPSGNRTKRILINVPGIYSDSFWASIIRG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6t22 Crystal structure of the EcoKMcrA N-terminal domain (NEco): recognition of modified cytosine bases without flipping.
Resolution2.21 Å
Binding residue
(original residue number in PDB)
S30 W31 G32 P33 S65 S66 S108 R109 K113 G118 N119 T121 K122
Binding residue
(residue number reindexed from 1)
S32 W33 G34 P35 S67 S68 S110 R111 K115 G120 N121 T123 K124
Enzymatic activity
Enzyme Commision number 3.1.21.-
External links
PDB RCSB:6t22, PDBe:6t22, PDBj:6t22
PDBsum6t22
PubMed31724709
UniProtP24200|MCRA_ECOLI Type IV methyl-directed restriction enzyme EcoKMcrA (Gene Name=mcrA)

[Back to BioLiP]