Structure of PDB 6t1f Chain A Binding Site BS01

Receptor Information
>6t1f Chain A (length=191) Species: 565050 (Caulobacter vibrioides NA1000) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SREAPIEILQRNPDTFREEDLEDLSNSIREKGVLQPILVRPSPDTAGEYQ
IVAGERRWRAAQRAGLKTVPIMVRELDDLAVLEIGIIENVQRADLNVLEE
ALSYKVLMEKFERTQENIAQTIGKSRSHVANTMRLLALPDEVQSYLVSGE
LTAGHARAIAAAADPVALAKQIIEGGLSVRETEALARKAPN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6t1f A CTP-dependent gating mechanism enables ParB spreading on DNA.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
M155 T161 Q162 R173 N178 R181 A208 R227 E230 R234
Binding residue
(residue number reindexed from 1)
M108 T114 Q115 R126 N131 R134 A161 R180 E183 R187
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6t1f, PDBe:6t1f, PDBj:6t1f
PDBsum6t1f
PubMed34397383
UniProtB8GW30|PARB_CAUVN Chromosome-partitioning protein ParB (Gene Name=parB)

[Back to BioLiP]