Structure of PDB 6sqn Chain A Binding Site BS01

Receptor Information
>6sqn Chain A (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKM
RGQAWVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sqn Expanding crystallization tools for nucleic acid complexes using U1A protein variants.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		Y13 N15 N16 E19 K22 S48 L49 K50 M51 R52 Q54 W56 Q85 K88 D90 S91 D92
Binding residue
(residue number reindexed from 1)		Y12 N14 N15 E18 K21 S47 L48 K49 M50 R51 Q53 W55 Q84 K87 D89 S90 D91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6sqn, PDBe:6sqn, PDBj:6sqn
PDBsum6sqn
PubMed32070773
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]