Structure of PDB 6sh8 Chain A Binding Site BS01

Receptor Information
>6sh8 Chain A (length=153) Species: 930945 (Sulfolobus islandicus REY15A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YEEDYKLALEAFKKVFNALTHYGAKQAFRSRARDLVEEIYNSGFIPTFFY
IISKAELNSDSLDSLISLFSSDNAILRGSDENVSYSAYLFIILYYLIKRG
IIEQKFLIQALRCEKTRLDLIDKLYNLAPIISAKIRTYLLAIKRLSEALI
EAR
Ligand information
>6sh8 Chain U (length=32) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaagucugguuucccuccaggguaucuuga
................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sh8 Structures of the Cmr-beta Complex Reveal the Regulation of the Immunity Mechanism of Type III-B CRISPR-Cas.
Resolution3.14 Å
Binding residue
(original residue number in PDB)		R31 R33 R35 D36 E39 K56 E83 Y87 R146 E149 A154 R155
Binding residue
(residue number reindexed from 1)		R29 R31 R33 D34 E37 K54 E81 Y85 R144 E147 A152 R153
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051607 defense response to virus
Cellular Component
GO:0005737 cytoplasm

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6sh8, PDBe:6sh8, PDBj:6sh8
PDBsum6sh8
PubMed32730741
UniProtF0NDX5

[Back to BioLiP]