Structure of PDB 6sf6 Chain A Binding Site BS01

Receptor Information
>6sf6 Chain A (length=216) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQQSGAELAKPGASVNLSCKASGYTFTNYWVHWVKQRPGQGLEWIGY
INPSNTYISYNQQFKDKATLTADKSSSTAYMQLSRLTYEDSSVYYCARGG
FFYDYDVWYFDVWGTGTTVTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYF
PEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCN
VAHPASSTKVDKKIVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sf6 Antibodies to cartilage oligomeric matrix protein in vivo are pathogenic and clinically relevant in rheumatoid arthritis
Resolution1.9 Å
Binding residue
(original residue number in PDB)		W33 Y50 N55 Y57 S59 G99
Binding residue
(residue number reindexed from 1)		W33 Y50 N55 Y57 S59 G99
External links