Structure of PDB 6sdy Chain A Binding Site BS01

Receptor Information
>6sdy Chain A (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMNPISRLAQIQQAKKEKEPEYTLLTERGLPRRREFVMQVKVGNHTAE
GTGTNKKVAKRNAAENMLEILGFK
Ligand information
>6sdy Chain B (length=34) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcagaagcugccucuucggaggcaguuucugcc
<<<<<<<<<<<<<<<....>>>>>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sdy Staufen1 reads out structure and sequence features in ARF1 dsRNA for target recognition.
ResolutionN/A
Binding residue
(original residue number in PDB)
M204 I207 S208 A211 Q212 Q215 K220 E221 R234 R236 F238 T254 N255 K256 K257 K260 R261
Binding residue
(residue number reindexed from 1)
M4 I7 S8 A11 Q12 Q15 K20 E21 R34 R36 F38 T54 N55 K56 K57 K60 R61
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6sdy, PDBe:6sdy, PDBj:6sdy
PDBsum6sdy
PubMed31875226
UniProtO95793|STAU1_HUMAN Double-stranded RNA-binding protein Staufen homolog 1 (Gene Name=STAU1)

[Back to BioLiP]