Structure of PDB 6sdw Chain A Binding Site BS01

Receptor Information
>6sdw Chain A (length=177) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMKSEISQVFEIALKRNLPVNFEVARESGPPHMKNFVTKVSVGEFVGE
GEGKSKKISKKNAAIAVLEELKKLPPLPAVERVKPRIKKKTKPIVKPQTS
PEYGQGINPISRLAQIQQAKKEKEPEYTLLTERGLPRRREFVMQVKVGNH
TAEGTGTNKKVAKRNAAENMLEILGFK
Ligand information
>6sdw Chain B (length=34) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcagaagcugccucuucggaggcaguuucugcc
<<<<<<<<<<<<<<<....>>>>>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sdw Staufen1 reads out structure and sequence features in ARF1 dsRNA for target recognition.
ResolutionN/A
Binding residue
(original residue number in PDB)
K102 S103 I105 F109 E110 K133 F135 V136 T137 S152 K153 K154 K157 K158 I191 Y200 Q202 N205 I207 S208 A211 Q212 Q215 K218 K220 E221 R234 R236 F238 T254 N255 K256 K257 K260 R261
Binding residue
(residue number reindexed from 1)
K5 S6 I8 F12 E13 K36 F38 V39 T40 S55 K56 K57 K60 K61 I94 Y103 Q105 N108 I110 S111 A114 Q115 Q118 K121 K123 E124 R137 R139 F141 T157 N158 K159 K160 K163 R164
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6sdw, PDBe:6sdw, PDBj:6sdw
PDBsum6sdw
PubMed31875226
UniProtO95793|STAU1_HUMAN Double-stranded RNA-binding protein Staufen homolog 1 (Gene Name=STAU1)

[Back to BioLiP]