Structure of PDB 6sat Chain A Binding Site BS01

Receptor Information
>6sat Chain A (length=85) Species: 196627 (Corynebacterium glutamicum ATCC 13032) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YQSTIVPVELHSFEDAQVIGGAFRDGDAVVFDMSLLSREEARRIVDFAAG
LCFALRGKMQKIDSVTFAVVPELSNISTSELERAA
Ligand information
>6sat Chain P (length=9) Species: 196627 (Corynebacterium glutamicum ATCC 13032) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DLDVPSFLQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sat Essential dynamic interdependence of FtsZ and SepF for Z-ring and septum formation in Corynebacterium glutamicum.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		Q81 F111
Binding residue
(residue number reindexed from 1)		Q17 F47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0090529 cell septum assembly

View graph for
Biological Process
External links
PDB RCSB:6sat, PDBe:6sat, PDBj:6sat
PDBsum6sat
PubMed32242019
UniProtQ8NNN6

[Back to BioLiP]