Structure of PDB 6s6h Chain A Binding Site BS01

Receptor Information
>6s6h Chain A (length=121) Species: 565050 (Caulobacter vibrioides NA1000) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLAVLEIGIIENVQRADLNVLEEALSYKVLMEKFERTQENIAQTIGKSRS
HVANTMRLLALPDEVQSYLVSGELTAGHARAIAAAADPVALAKQIIEGGL
SVRETEALARKAPKSKGGRPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6s6h Diversification of DNA-Binding Specificity by Permissive and Specificity-Switching Mutations in the ParB/Noc Protein Family.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		T161 Q162 R173 N178 R181 R204 A208 R227 E230 R234
Binding residue
(residue number reindexed from 1)		T37 Q38 R49 N54 R57 R80 A84 R103 E106 R110
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6s6h, PDBe:6s6h, PDBj:6s6h
PDBsum6s6h
PubMed32698006
UniProtB8GW30|PARB_CAUVN Chromosome-partitioning protein ParB (Gene Name=parB)

[Back to BioLiP]