Structure of PDB 6ryo Chain A Binding Site BS01

Receptor Information
>6ryo Chain A (length=155) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMHKKYFIGTSILIAVFVVIFDQVTKYIIATTMKIGDSFEVIPHFLNITS
HRNNGAAWGILSGKMTFFFIITIIILIALVYFFIKDAQYNLFMQVAISLL
FAGALGNFIDRVLTGEVVDFIDTNIFGYDFPIFNIADSSLTIGVILIIIA
LLKDT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ryo Structures of lipoprotein signal peptidase II from Staphylococcus aureus complexed with antibiotics globomycin and myxovirescin.
Resolution1.924 Å
Binding residue
(original residue number in PDB)		N52 W57 F67 T71 A103 N106 R110 V116 D118 D136
Binding residue
(residue number reindexed from 1)		N53 W58 F68 T72 A104 N107 R111 V117 D119 D137
Enzymatic activity
Enzyme Commision number 3.4.23.36: signal peptidase II.
Gene Ontology
Molecular Function
GO:0004190 aspartic-type endopeptidase activity
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ryo, PDBe:6ryo, PDBj:6ryo
PDBsum6ryo
PubMed31919415
UniProtQ6GHN9|LSPA_STAAR Lipoprotein signal peptidase (Gene Name=lspA)

[Back to BioLiP]