Structure of PDB 6rup Chain A Binding Site BS01

Receptor Information
>6rup Chain A (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSQLGDVSQ
KTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQAT
TIIADNIIFLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6rup Dominant mutations in mtDNA maintenance gene SSBP1 cause optic atrophy and foveopathy.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		V78 S79 Q80
Binding residue
(residue number reindexed from 1)		V48 S49 Q50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0003697 single-stranded DNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0006260 DNA replication
GO:0006264 mitochondrial DNA replication
GO:0006268 DNA unwinding involved in DNA replication
GO:0007005 mitochondrion organization
GO:0051096 positive regulation of helicase activity
GO:0051289 protein homotetramerization
GO:0090297 positive regulation of mitochondrial DNA replication
Cellular Component
GO:0005634 nucleus
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0042645 mitochondrial nucleoid
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6rup, PDBe:6rup, PDBj:6rup
PDBsum6rup
PubMed31550237
UniProtQ04837|SSBP_HUMAN Single-stranded DNA-binding protein, mitochondrial (Gene Name=SSBP1)

[Back to BioLiP]