Structure of PDB 6rjp Chain A Binding Site BS01

Receptor Information
>6rjp Chain A (length=150) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVE
KNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGIL
IKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6rjp N-locking stabilization of covalent helical peptides: Application to Bfl-1 antagonists.
Resolution2.57 Å
Binding residue
(original residue number in PDB)		V44 V48 N51 L52 C55 V74 K77 E78 D81 N85 G87 R88 T91 K147 F148
Binding residue
(residue number reindexed from 1)		V45 V49 N52 L53 C56 V75 K78 E79 D82 N86 G88 R89 T92 K148 F149
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:6rjp, PDBe:6rjp, PDBj:6rjp
PDBsum6rjp
PubMed31898401
UniProtQ16548|B2LA1_HUMAN Bcl-2-related protein A1 (Gene Name=BCL2A1)

[Back to BioLiP]