Structure of PDB 6rd2 Chain A Binding Site BS01

Receptor Information
>6rd2 Chain A (length=110) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGR
KIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFA
SAMMHALEVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6rd2 Designed nanomolar small-molecule inhibitors of Ena/VASP EVH1 interaction impair invasion and extravasation of breast cancer cells.
Resolution1.0 Å
Binding residue
(original residue number in PDB)
M14 K22 W23
Binding residue
(residue number reindexed from 1)
M13 K21 W22
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6rd2, PDBe:6rd2, PDBj:6rd2
PDBsum6rd2
PubMed33184177
UniProtQ8N8S7|ENAH_HUMAN Protein enabled homolog (Gene Name=ENAH)

[Back to BioLiP]