Structure of PDB 6rcn Chain A Binding Site BS01

Receptor Information
>6rcn Chain A (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQP
DELLDSMSDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGL
CPLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEF
APKKAASHRALDAISESIKELQFYRNNIFK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6rcn Dinucleotide Degradation by REXO2 Maintains Promoter Specificity in Mammalian Mitochondria.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		E49 M50 L53 W96 C97 H101 N142 S143 S170 H194
Binding residue
(residue number reindexed from 1)		E13 M14 L17 W60 C61 H65 N106 S107 S134 H158
Enzymatic activity
Enzyme Commision number 3.1.15.-
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:6rcn, PDBe:6rcn, PDBj:6rcn
PDBsum6rcn
PubMed31588022
UniProtQ9Y3B8|ORN_HUMAN Oligoribonuclease, mitochondrial (Gene Name=REXO2)

[Back to BioLiP]