Structure of PDB 6ra4 Chain A Binding Site BS01

Receptor Information
>6ra4 Chain A (length=127) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEIT
HCGQMKRKYRVCNVTRRPASHQTFPLTVECTVAQYFKDRHKLVLRYPHLP
CLQVGQEQKHTYLPLEVCNIVAGQRCI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ra4 How to Computationally Stack the Deck for Hit-to-Lead Generation: In Silico Molecular Interaction Energy Profiling for de Novo siRNA Guide Strand Surrogate Selection.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		K258 H263 M267 R269 R272 F286 L288 Y303 H308 K327 H328 T329 Y330
Binding residue
(residue number reindexed from 1)		K46 H51 M55 R57 R60 F74 L76 Y85 H90 K109 H110 T111 Y112
Enzymatic activity
Enzyme Commision number 3.1.26.n2: argonaute-2.
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6ra4, PDBe:6ra4, PDBj:6ra4
PDBsum6ra4
PubMed31021613
UniProtQ9UKV8|AGO2_HUMAN Protein argonaute-2 (Gene Name=AGO2)

[Back to BioLiP]