Structure of PDB 6r59 Chain A Binding Site BS01

Receptor Information

>6r59 Chain A (length=193) Species: 1496 (Clostridioides difficile) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

STTIQQNKDTLSQIVVFPTGNYDKNEANAMVNRLANIDGKYLNALKQNNL
KIKLLSGKLTDEKEYAYLKGVVPKGWEGTGKTWDDVPGLGGSTVALRIGF
SNKGKGHDAINLELHATAHAIDHIVLNDISKSAQFKQIFAKEGRSLGNVN
FLGVYPEEFFAESFAYYYLNQDTNSKLKSACPQTYSFLQNLAK

Ligand information

>6r59 Chain E (length=7) Species: 1496 (Clostridioides difficile) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EVAPPVP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6r59 Molecular determinants of the mechanism and substrate specificity ofClostridium difficileproline-proline endopeptidase-1.
Resolution	1.65 Å
Binding residue (original residue number in PDB)	P100 W103 W110 L116 G117 G118 S119 H134 D135 H142 H146 H150 N175 F178
Binding residue (residue number reindexed from 1)	P73 W76 W83 L89 G90 G91 S92 H107 D108 H115 H119 H123 N148 F151

Enzymatic activity

Enzyme Commision number

3.4.24.89: Pro-Pro endopeptidase.

Gene Ontology

	Molecular Function
GO:0008237	metallopeptidase activity
GO:0046872	metal ion binding

	Biological Process
GO:0006508	proteolysis

	Cellular Component
GO:0005576	extracellular region

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6r59, PDBe:6r59, PDBj:6r59
PDBsum	6r59
PubMed	31182482
UniProt	Q183R7\|PPEP1_CLOD6 Pro-Pro endopeptidase (Gene Name=zmp1)

[Back to BioLiP]