Structure of PDB 6r50 Chain A Binding Site BS01

Receptor Information
>6r50 Chain A (length=195) Species: 1496 (Clostridioides difficile) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDSTTIQQNKDTLSQIVVFPTGNYDKNEANAMVNRLANIDGKYLNALKQN
NLKIKLLSGKLTDEKEYAYLKGVVPKGWEGTGKTWDDVPGLGGSTVALRI
GFSNKGKGHDAINLELHATAHAIDHIVLNDISKSAQFKQIFAKEGRSLGN
VNFLGVYPEEFFAESFAYYYLNQDTNSKLKSACPQTYSFLQNLAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6r50 Molecular determinants of the mechanism and substrate specificity ofClostridium difficileproline-proline endopeptidase-1.
Resolution1.807 Å
Binding residue
(original residue number in PDB)		W103 W110 G115 L116 G117 G118 S119 H134 D135 L139 H142 H146 H150 N175 F178 E185
Binding residue
(residue number reindexed from 1)		W78 W85 G90 L91 G92 G93 S94 H109 D110 L114 H117 H121 H125 N150 F153 E160
Enzymatic activity
Enzyme Commision number 3.4.24.89: Pro-Pro endopeptidase.
Gene Ontology
Molecular Function
GO:0008237 metallopeptidase activity
GO:0046872 metal ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6r50, PDBe:6r50, PDBj:6r50
PDBsum6r50
PubMed31182482
UniProtQ183R7|PPEP1_CLOD6 Pro-Pro endopeptidase (Gene Name=zmp1)

[Back to BioLiP]