Structure of PDB 6r2v Chain A Binding Site BS01

Receptor Information
>6r2v Chain A (length=62) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PIFVNAKQYQAILRRRERRAKLEAQNKLIKVRKPYLHESRHLHALKRVRG
SGGRFLNTKKHQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6r2v Structural determinants for NF-Y subunit organization and NF-Y/DNA association in plants.
Resolution2.503 Å
Binding residue
(original residue number in PDB)		H208 S210 R211 H214 R218 R225 F226 N228 T229
Binding residue
(residue number reindexed from 1)		H37 S39 R40 H43 R47 R54 F55 N57 T58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0016602 CCAAT-binding factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6r2v, PDBe:6r2v, PDBj:6r2v
PDBsum6r2v
PubMed33098724
UniProtQ9LVJ7|NFYA6_ARATH Nuclear transcription factor Y subunit A-6 (Gene Name=NFYA6)

[Back to BioLiP]