Structure of PDB 6r15 Chain A Binding Site BS01

Receptor Information
>6r15 Chain A (length=198) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGITEAQARAIVNSALKLYSQDKTGMVDFALESGGGSILSTRCSETYETK
TALMSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMMIH
PAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQD
GESLQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHGEPVK
Ligand information
>6r15 Chain B (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EEDYSCALSNNFARSFHPMLRYTNGPPPL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6r15 A molecular mechanism for LINC complex branching by structurally diverse SUN-KASH 6:6 assemblies.
Resolution1.82 Å
Binding residue
(original residue number in PDB)		E646 G649 G650 I652 S654 T655 R656 C657 S658 S679 P682 R683 Y704 R708 E751
Binding residue
(residue number reindexed from 1)		E32 G35 G36 I38 S40 T41 R42 C43 S44 S65 P68 R69 Y90 R94 E137
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6r15, PDBe:6r15, PDBj:6r15
PDBsum6r15
PubMed33393904
UniProtO94901|SUN1_HUMAN SUN domain-containing protein 1 (Gene Name=SUN1)

[Back to BioLiP]