Structure of PDB 6qxz Chain A Binding Site BS01

Receptor Information
>6qxz Chain A (length=79) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSRRASVGSEFTESAWVRCDDCFKWRRIPASVVGSIDESSRWICMNNSDK
RFADCSKSQEMSNEEINEELGIGQDEADA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qxz The Arabidopsis (ASHH2) CW domain binds monomethylated K4 of the histone H3 tail through conformational selection.
ResolutionN/A
Binding residue
(original residue number in PDB)		A854 S855 E859 F860 T861 A864 W865 V866 R867 D869 W874 R876 E887 I915 E918 L919
Binding residue
(residue number reindexed from 1)		A5 S6 E10 F11 T12 A15 W16 V17 R18 D20 W25 R27 E38 I66 E69 L70
Enzymatic activity
Enzyme Commision number 2.1.1.-
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:6qxz, PDBe:6qxz, PDBj:6qxz
PDBsum6qxz
PubMed32083791
UniProtQ2LAE1|ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 (Gene Name=ASHH2)

[Back to BioLiP]