Structure of PDB 6qwf Chain A Binding Site BS01

Receptor Information

>6qwf Chain A (length=236) Species: 1639 (Listeria monocytogenes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSI
SENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATVYVIKINE
LKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILT
YVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVY
KNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN

Ligand information

>6qwf Chain C (length=30) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttgaggcattaacatttgttaacgacgata

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6qwf A Novel Growth-Based Selection Strategy Identifies New Constitutively Active Variants of the Major Virulence Regulator PrfA in Listeria monocytogenes.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	T170 M171 S187
Binding residue (residue number reindexed from 1)	T169 M170 S186

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6qwf, PDBe:6qwf, PDBj:6qwf
PDBsum	6qwf
PubMed	32179627
UniProt	P22262\|PRFA_LISMO Listeriolysin regulatory protein (Gene Name=prfA)

[Back to BioLiP]